The store will not work correctly when cookies are disabled.
SUCNR1
| Description | Succinate receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 56670 |
|---|
| Uniprot Accession IDs | A8K305 Q8TDQ8 |
|---|
| Ensembl ID | ENSP00000355156 |
|---|
| Symbol | GPR91 GPR91 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 738824 | SUCNR1 | succinate receptor 1 | 9598 | VGNC:12200 | OMA, EggNOG |
| Mouse | 84112 | Sucnr1 | succinate receptor 1 | 10090 | MGI:1934135 | Inparanoid, OMA, EggNOG |
| Rat | 408199 | Sucnr1 | succinate receptor 1 | 10116 | RGD:1303193 | Inparanoid, OMA, EggNOG |
| Dog | 485719 | SUCNR1 | succinate receptor 1 | 9615 | VGNC:46968 | Inparanoid, OMA, EggNOG |
| Horse | 100056372 | SUCNR1 | succinate receptor 1 | 9796 | VGNC:23745 | Inparanoid, OMA, EggNOG |
| Cow | 539622 | SUCNR1 | succinate receptor 1 | 9913 | VGNC:35458 | OMA, EggNOG |
| Pig | 100739158 | SUCNR1 | succinate receptor 1 | 9823 | | OMA, EggNOG |
| Platypus | 100083905 | SUCNR1 | succinate receptor 1 | 9258 | | OMA, EggNOG |
| Chicken | 771768 | SUCNR1 | succinate receptor 1 | 9031 | CGNC:7886 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
