The store will not work correctly when cookies are disabled.
TNFRSF13C
| Description | Tumor necrosis factor receptor superfamily member 13C |
|---|
Gene and Protein Information
| Gene ID | 115650 |
|---|
| Uniprot Accession IDs | Q96RJ3 |
|---|
| Ensembl ID | ENSP00000291232 |
|---|
| Symbol | BAFFR BR3 BAFFR CD268 CVID4 BAFF-R BROMIX prolixin |
|---|
| Sequence | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 104003794 | TNFRSF13C | TNF receptor superfamily member 13C | 9598 | VGNC:12933 | OMA, EggNOG |
| Mouse | 72049 | Tnfrsf13c | tumor necrosis factor receptor superfamily, member 13c | 10090 | MGI:1919299 | Inparanoid, OMA, EggNOG |
| Rat | 500910 | Tnfrsf13c | TNF receptor superfamily member 13C | 10116 | RGD:1560810 | Inparanoid, OMA |
| Dog | 607785 | TNFRSF13C | TNF receptor superfamily member 13C | 9615 | VGNC:54377 | Inparanoid, OMA, EggNOG |
| Horse | 100070724 | TNFRSF13C | TNF receptor superfamily member 13C | 9796 | VGNC:24366 | Inparanoid, OMA, EggNOG |
| Chicken | 417983 | TNFRSF13C | TNF receptor superfamily member 13C | 9031 | CGNC:13832 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
