The store will not work correctly when cookies are disabled.
Protein or Target Summary
Tumor necrosis factor receptor superfamily member 13C
| Gene ID | 115650 |
|---|
| uniprot | Q96RJ3 |
|---|
| Gene Name | TNFRSF13C |
|---|
| Ensernbl ID | ENSP00000291232 |
|---|
| Sequence | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 115650 | TNFRSF13C | Tumor necrosis factor receptor superfamily member 13C | Q96RJ3 |
| MOUSE | 72049 | Tnfrsf13c | Tumor necrosis factor receptor superfamily member 13C | Q9D8D0 |
| MOUSE | | Tnfrsf13c | TRAF3 binding protein | Q8R4W8 |
| MOUSE | | Tnfrsf13c | Tumor necrosis factor receptor superfamily member 13C | A0A2R8VI78 |
| MOUSE | 72049 | Tnfrsf13c | Tnfrsf13c protein | Q3SXS7 |
| MOUSE | 72049 | Tnfrsf13c | BAFF receptor | Q3SXS6 |
| MOUSE | | Tnfrsf13c | Tumor necrosis factor receptor superfamily member 13C | Q3U106 |
| RAT | 500910 | Tnfrsf13c | TNF receptor superfamily member 13C | D4A281 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
