JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Ubiquitin carboxyl-terminal hydrolase 30

Gene ID	84749
uniprot	Q70CQ3
Gene Name	USP30
Ensernbl ID	ENSP00000257548
Family	Belongs to the peptidase C19 family.
Sequence	MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	84749	USP30	Ubiquitin carboxyl-terminal hydrolase 30	Q70CQ3
MOUSE	100756	Usp30	Ubiquitin carboxyl-terminal hydrolase 30	Q3UN04
MOUSE		Usp30	Ubiquitin carboxyl-terminal hydrolase 30	A0A0J9YV73
MOUSE		Usp30	Ubiquitin carboxyl-terminal hydrolase 30	A0A0G2JDF7
RAT		Usp30	Ubiquitin carboxyl-terminal hydrolase 30	A0A0G2K3K1
RAT	304579	Usp30	Ubiquitin carboxyl-terminal hydrolase 30	D3ZPG5

Protein Classes

PANTHER Classes
protein / cysteine protease / Ubiquitin carboxyl-terminal hydrolase 30

DTO Classes
protein / Enzyme / Protease / Cysteine protease / Ubiquitin carboxyl-terminal hydrolase 30

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx