The store will not work correctly when cookies are disabled.
USP30
| Description | Ubiquitin carboxyl-terminal hydrolase 30 |
|---|
Gene and Protein Information
| Gene ID | 84749 |
|---|
| Uniprot Accession IDs | Q8WTU7 Q96JX4 Q9BSS3 |
|---|
| Ensembl ID | ENSP00000257548 |
|---|
| Family | Belongs to the peptidase C19 family. |
|---|
| Sequence | MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERKKRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLLHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQSPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDTVRKASLQEVLSSSAYLLFYERVLSRMQHQSQECKSEE Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452215 | USP30 | ubiquitin specific peptidase 30 | 9598 | VGNC:13490 | OMA, EggNOG |
| Macaque | 706607 | USP30 | ubiquitin specific peptidase 30 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 100756 | Usp30 | ubiquitin specific peptidase 30 | 10090 | MGI:2140991 | Inparanoid, OMA, EggNOG |
| Rat | 304579 | Usp30 | ubiquitin specific peptidase 30 | 10116 | RGD:1307949 | Inparanoid, OMA, EggNOG |
| Dog | 611662 | USP30 | ubiquitin specific peptidase 30 | 9615 | VGNC:52974 | Inparanoid, OMA, EggNOG |
| Horse | 100066762 | USP30 | ubiquitin specific peptidase 30 | 9796 | VGNC:50985 | Inparanoid, OMA, EggNOG |
| Cow | 100140210 | USP30 | ubiquitin specific peptidase 30 | 9913 | VGNC:53928 | Inparanoid, OMA, EggNOG |
| Pig | 100520333 | ALKBH2 | alkB homolog 2, alpha-ketoglutarate dependent dioxygenase | 9823 | | OMA, EggNOG |
| Opossum | | USP30 | ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065] | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | USP30 | ubiquitin specific peptidase 30 [Source:HGNC Symbol;Acc:HGNC:20065] | 9258 | | OMA, EggNOG |
| Xenopus | 733894 | usp30 | ubiquitin specific peptidase 30 | 8364 | XB-GENE-981069 | Inparanoid, OMA, EggNOG |
| Zebrafish | 559099 | usp30 | ubiquitin specific peptidase 30 | 7955 | ZDB-GENE-060526-335 | Inparanoid, OMA, EggNOG |
| C. elegans | 175310 | Y67D2.2 | Ubiquitin carboxyl-terminal hydrolase | 6239 | | OMA, EggNOG |
| Fruitfly | 31519 | Usp30 | Ubiquitin specific protease 30 | 7227 | FBgn0029819 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
cysteine protease / Ubiquitin carboxyl-terminal hydrolase 30
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
