The store will not work correctly when cookies are disabled.
Protein or Target Summary
Vesicle-associated membrane protein 1
| Gene ID | 6843 |
|---|
| uniprot | P23763 |
|---|
| Gene Name | VAMP1 |
|---|
| Ensernbl ID | ENSP00000379602 |
|---|
| Family | Belongs to the synaptobrevin family. |
|---|
| Sequence | MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYFFT Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6843 | VAMP1 | Vesicle-associated membrane protein 1 | P23763 |
| MOUSE | | Vamp1 | Uncharacterized protein | Q9CXX2 |
| MOUSE | | Vamp1 | Uncharacterized protein | Q3V3N8 |
| MOUSE | | Vamp1 | Vesicle-associated membrane protein 1 | A0A0N4SUV3 |
| MOUSE | | Vamp1 | Vesicle-associated membrane protein 1 | D3YTU0 |
| MOUSE | 22317 | Vamp1 | Vesicle-associated membrane protein 1 | Q62442 |
| RAT | 25624 | Vamp1 | Vesicle-associated membrane protein 1 | Q63666 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
