JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

V-type proton ATPase subunit D

Gene ID	51382
uniprot	Q9Y5K8
Gene Name	ATP6V1D
Ensernbl ID	ENSP00000216442
Family	Belongs to the V-ATPase D subunit family.
Sequence	MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	51382	ATP6V1D	V-type proton ATPase subunit D	Q9Y5K8
MOUSE		Atp6v1d	Uncharacterized protein	Q3UJH5
MOUSE		Atp6v1d	Uncharacterized protein	Q3UK81
MOUSE		Atp6v1d	Uncharacterized protein	Q9CTI8
MOUSE		Atp6v1d	Uncharacterized protein	Q3U684
MOUSE	73834	Atp6v1d	ATPase, H+ transporting, lysosomal V1 subunit D, isoform CRA_b	Q3U861
MOUSE	73834	Atp6v1d	V-type proton ATPase subunit D	P57746
RAT	299159	Atp6v1d	ATPase H+-transporting V1 subunit D	Q6P503

Protein Classes

DTO Classes
protein / Transporter / F-type and V-type ATPases / V-type ATPase / V-type proton ATPase subunit D

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx