JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Ubiquitin-conjugating enzyme E2 D1

Gene ID	7321
uniprot	P51668
Gene Name	UBE2D1
Ensernbl ID	ENSP00000363019
Family	Belongs to the ubiquitin-conjugating enzyme family.
Sequence	MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7321	UBE2D1	Ubiquitin-conjugating enzyme E2 D1	P51668
MOUSE	216080	Ube2d1	Ubiquitin-conjugating enzyme E2D 1, UBC4/5 homolog (Yeast), isoform CRA_b	Q3UFQ4
MOUSE	216080	Ube2d1	Ubiquitin-conjugating enzyme E2 D1	P61080
RAT	361831	Ube2d1	Ubiquitin-conjugating enzyme E2 D1	D3ZDK2

Protein Classes

PANTHER Classes
protein / ligase / Ubiquitin-conjugating enzyme E2 D1

DTO Classes
protein / Enzyme / Ligase / Ubiquitin-conjugating enzyme E2 D1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx