JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

VHL

Description	von Hippel-Lindau disease tumor suppressor

Gene and Protein Information

Gene ID	7428
Uniprot Accession IDs	B2RE45 Q13599 Q6PDA9
Ensembl ID	ENSP00000256474
Symbol	RCA1 VHL1 pVHL HRCA1
Family	Belongs to the VHL family.
Sequence	MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	749769	VHL	von Hippel-Lindau tumor suppressor	9598	VGNC:48915	Inparanoid, OMA
Mouse	22346	Vhl	von Hippel-Lindau tumor suppressor	10090	MGI:103223	Inparanoid, OMA, EggNOG
Rat	24874	Vhl	von Hippel-Lindau tumor suppressor	10116	RGD:3960	Inparanoid, OMA, EggNOG
Cow	540957	VHL	von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase	9913		Inparanoid, OMA, EggNOG
Pig	100739306	VHL	von Hippel-Lindau tumor suppressor	9823		OMA, EggNOG
Chicken	416117	VHL	von Hippel-Lindau tumor suppressor	9031	CGNC:50168	Inparanoid, OMA
Anole lizard	100560920	vhl	von Hippel-Lindau tumor suppressor	28377		OMA, EggNOG
Xenopus	549121	vhl	von Hippel-Lindau tumor suppressor	8364	XB-GENE-493997	Inparanoid, OMA, EggNOG
Zebrafish	791202	vhl	von Hippel-Lindau tumor suppressor	7955	ZDB-GENE-070112-1042	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / ligase / von Hippel-Lindau disease tumor suppressor

DTO Classes
protein / Enzyme / Ligase / von Hippel-Lindau disease tumor suppressor

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source