The store will not work correctly when cookies are disabled.
Protein or Target Summary
von Hippel-Lindau disease tumor suppressor
| Gene ID | 7428 |
|---|
| uniprot | P40337 |
|---|
| Gene Name | VHL |
|---|
| Ensernbl ID | ENSP00000256474 |
|---|
| Family | Belongs to the VHL family. |
|---|
| Sequence | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 7428 | VHL | von Hippel-Lindau disease tumor suppressor | P40337 |
| MOUSE | | Vhl | von Hippel-Lindau disease tumor suppressor | A0A0N4SW09 |
| MOUSE | 22346 | Vhl | von Hippel-Lindau syndrome homolog, isoform CRA_a | Q3TTE7 |
| MOUSE | 22346 | Vhl | von Hippel-Lindau disease tumor suppressor | P40338 |
| RAT | 24874 | Vhl | von Hippel-Lindau disease tumor suppressor | Q64259 |
Protein Classes
PANTHER Classes protein /
ligase / von Hippel-Lindau disease tumor suppressor
DTO Classes protein /
Enzyme /
Ligase / von Hippel-Lindau disease tumor suppressor
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
