The store will not work correctly when cookies are disabled.
SLC32A1
| Description | Vesicular inhibitory amino acid transporter |
|---|
Gene and Protein Information
| Gene ID | 140679 |
|---|
| Uniprot Accession IDs | Q8N489 |
|---|
| Ensembl ID | ENSP00000217420 |
|---|
| Symbol | VGAT VIAAT VGAT VIAAT |
|---|
| Family | Belongs to the amino acid/polyamine transporter 2 family. |
|---|
| Sequence | MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPACYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRLLWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469940 | SLC32A1 | solute carrier family 32 member 1 | 9598 | VGNC:9984 | OMA, EggNOG |
| Macaque | 698315 | SLC32A1 | solute carrier family 32 member 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 22348 | Slc32a1 | solute carrier family 32 (GABA vesicular transporter), member 1 | 10090 | MGI:1194488 | Inparanoid, OMA, EggNOG |
| Rat | 83612 | Slc32a1 | solute carrier family 32 member 1 | 10116 | RGD:621402 | Inparanoid, OMA, EggNOG |
| Dog | 485870 | SLC32A1 | solute carrier family 32 member 1 | 9615 | VGNC:46356 | Inparanoid, OMA, EggNOG |
| Horse | 100146532 | SLC32A1 | solute carrier family 32 member 1 | 9796 | VGNC:23157 | Inparanoid, OMA, EggNOG |
| Cow | 100301361 | SLC32A1 | solute carrier family 32 member 1 | 9913 | VGNC:34815 | Inparanoid, OMA, EggNOG |
| Pig | 100517013 | SLC32A1 | solute carrier family 32 member 1 | 9823 | | OMA, EggNOG |
| Opossum | 100029278 | SLC32A1 | solute carrier family 32 member 1 | 13616 | | Inparanoid, EggNOG |
| Chicken | 419167 | SLC32A1 | solute carrier family 32 member 1 | 9031 | CGNC:2585 | Inparanoid, OMA |
| Anole lizard | 100553313 | slc32a1 | solute carrier family 32 member 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448348 | slc32a1 | solute carrier family 32 member 1 | 8364 | XB-GENE-489830 | Inparanoid, OMA, EggNOG |
| Zebrafish | 798575 | slc32a1 | solute carrier family 32 (GABA vesicular transporter), member 1 | 7955 | ZDB-GENE-061201-1 | Inparanoid, OMA, EggNOG |
| C. elegans | 176431 | unc-47 | Vesicular GABA transporter | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 36574 | VGAT | Vesicular GABA Transporter | 7227 | FBgn0033911 | Inparanoid, EggNOG |
| S.cerevisiae | 853457 | AVT1 | Avt1p | 4932 | S000003761 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
