JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

TYRO protein tyrosine kinase-binding protein

Gene ID	7305
uniprot	O43914
Gene Name	TYROBP
Ensernbl ID	ENSP00000262629
Family	Belongs to the TYROBP family.
Sequence	MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7305	TYROBP	TYRO protein tyrosine kinase-binding protein	O43914
MOUSE		Tyrobp	TYRO protein tyrosine kinase-binding protein	A0A140LHP7
MOUSE		Tyrobp	TYRO protein tyrosine kinase-binding protein	A0A140LI31
MOUSE	22177	Tyrobp	TYRO protein tyrosine kinase binding protein, isoform CRA_b	Q3U419
MOUSE	22177	Tyrobp	TYRO protein tyrosine kinase-binding protein	O54885
RAT	361537	Tyrobp	TYRO protein tyrosine kinase-binding protein	Q6X9T7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx