The store will not work correctly when cookies are disabled.
Protein or Target Summary
NEDD8-conjugating enzyme UBE2F
| Gene ID | 140739 |
|---|
| uniprot | Q969M7 |
|---|
| Gene Name | UBE2F |
|---|
| Ensernbl ID | ENSP00000478474 |
|---|
| Family | Belongs to the ubiquitin-conjugating enzyme family. UBE2F subfamily. |
|---|
| Sequence | MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPNKLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYIKRYAR Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 140739 | UBE2F | NEDD8-conjugating enzyme UBE2F | Q969M7 |
| MOUSE | | Ube2f | NEDD8-conjugating enzyme UBE2F | A0A087WQR9 |
| MOUSE | | Ube2f | Uncharacterized protein | Q3V3M0 |
| MOUSE | 67921 | Ube2f | NEDD8-conjugating enzyme UBE2F | Q9CY34 |
| RAT | 363284 | Ube2f | NEDD8-conjugating enzyme UBE2F | Q5U203 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
