Protein or Target Summary

Cleavage and polyadenylation specificity factor subunit 5

Gene ID	11051
uniprot	O43809
Gene Name	NUDT21
Ensernbl ID	ENSP00000300291
Family	Belongs to the Nudix hydrolase family. CPSF5 subfamily.
Sequence	MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	11051	NUDT21	Cleavage and polyadenylation specificity factor subunit 5	O43809
MOUSE	68219	Nudt21	Cleavage and polyadenylation specificity factor subunit 5	Q9CQF3
MOUSE		Nudt21	Cleavage and polyadenylation-specificity factor subunit 5	A0A1D5RLT7
MOUSE		Nudt21	Cleavage and polyadenylation-specificity factor subunit 5	A0A1D5RM23
MOUSE		Nudt21	Cleavage and polyadenylation-specificity factor subunit 5	A0A1D5RLS2
MOUSE		Nudt21	Uncharacterized protein	Q9CZQ0
RAT	291877	Nudt21	Cleavage and polyadenylation specificity factor subunit 5	Q4KM65
RAT	291877	Nudt21	Cleavage and polyadenylation specific factor 5	B4F764

Protein Classes

PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Cleavage and polyadenylation specificity factor subunit 5

DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Cleavage and polyadenylation specificity factor subunit 5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx