JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

NUDT21

Description	Cleavage and polyadenylation specificity factor subunit 5

Gene and Protein Information

Gene ID	11051
Uniprot Accession IDs	Q6IB85 Q6NE84
Ensembl ID	ENSP00000300291
Symbol	CFIM25 CPSF25 CPSF5 CPSF5 CFIM25
Family	Belongs to the Nudix hydrolase family. CPSF5 subfamily.
Sequence	MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	454100	NUDT21	nudix hydrolase 21	9598	VGNC:5857	OMA, EggNOG
Mouse	68219	Nudt21	nudix (nucleoside diphosphate linked moiety X)-type motif 21	10090	MGI:1915469	Inparanoid, OMA, EggNOG
Rat	291877	Nudt21	nudix hydrolase 21	10116	RGD:1305766	Inparanoid, OMA
Horse	100051355	NUDT21	nudix hydrolase 21	9796	VGNC:20947	Inparanoid, OMA, EggNOG
Cow	518859	NUDT21	nudix hydrolase 21	9913	VGNC:32336	Inparanoid, OMA, EggNOG
Opossum	100015269	NUDT21	nudix hydrolase 21	13616		Inparanoid, EggNOG
Platypus		NUDT21	nudix hydrolase 21 [Source:HGNC Symbol;Acc:HGNC:13870]	9258		OMA, EggNOG
Chicken	100858636	NUDT21	nudix hydrolase 21	9031	CGNC:66135	OMA, EggNOG
Anole lizard	100560799	nudt21	nudix hydrolase 21	28377		Inparanoid, OMA, EggNOG
Xenopus	550016	nudt21	nudix hydrolase 21	8364	XB-GENE-921415	Inparanoid, OMA, EggNOG
Zebrafish	394092	nudt21	nudix hydrolase 21	7955	ZDB-GENE-040426-1316	Inparanoid, OMA, EggNOG
C. elegans	172657	cfim-1	Cleavage Factor IM (CFIm) homolog	6239		Inparanoid, OMA, EggNOG
Fruitfly	39083	CG3689	CG3689 gene product from transcript CG3689-RC	7227	FBgn0035987	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein / nucleic acid binding / mRNA splicing factor / Cleavage and polyadenylation specificity factor subunit 5

DTO Classes
protein / Nucleic acid binding / RNA binding protein / mRNA processing factor / mRNA splicing factor / Cleavage and polyadenylation specificity factor subunit 5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]