JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Ubiquitin-conjugating enzyme E2 D3

Gene ID	7323
uniprot	P61077
Gene Name	UBE2D3
Ensernbl ID	ENSP00000349722
Family	Belongs to the ubiquitin-conjugating enzyme family.
Sequence	MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7323	UBE2D3	Ubiquitin-conjugating enzyme E2 D3	P61077
MOUSE		Ube2d3	Uncharacterized protein	Q9D7F5
MOUSE		Ube2d3	Ubiquitin-conjugating enzyme E2 D3	A0A0G2JF40
MOUSE		Ube2d3	Ubiquitin-conjugating enzyme E2 D3	A0A0G2JE32
MOUSE		Ube2d3	Ubiquitin-conjugating enzyme E2 D3	A0A0G2JGZ3
MOUSE		Ube2d3	Ubiquitin-conjugating enzyme E2 D3	A0A0G2JGL0
MOUSE		Ube2d3	Uncharacterized protein	Q9D1S1
MOUSE		Ube2d3	Uncharacterized protein	Q3U5V6
MOUSE	66105	Ube2d3	MCG22362, isoform CRA_a	Q4QQL2
MOUSE		Ube2d3	Ube2d3 protein	Q05CK8
MOUSE	66105	Ube2d3	Ubiquitin-conjugating enzyme E2 D3	P61079
RAT		Ube2d3	Ubiquitin-conjugating enzyme E2 D3	A0A0G2K739
RAT		Ube2d3	Ubiquitin-conjugating enzyme E2 D3	A0A0G2JV72
RAT	81920	Ube2d3	Ubiquitin-conjugating enzyme E2 D3	P61078

Protein Classes

PANTHER Classes
protein / ligase / Ubiquitin-conjugating enzyme E2 D3

DTO Classes
protein / Enzyme / Ligase / Ubiquitin-conjugating enzyme E2 D3

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx