Protein or Target Summary
Transcriptional coactivator YAP1
Gene ID | 10413 |
---|---|
uniprot | P46937 |
Gene Name | YAP1 |
Ensernbl ID | ENSP00000478927 |
Family | Belongs to the YAP1 family. |
Sequence | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 10413 | YAP1 | Transcriptional coactivator YAP1 | P46937 |
MOUSE | Yap1 | Transcriptional coactivator YAP1 | G3UYA6 | |
MOUSE | Yap1 | Transcriptional coactivator YAP1 | G3UYW7 | |
MOUSE | Yap1 | Transcriptional coactivator YAP1 | G3UYV4 | |
MOUSE | Yap1 | Transcriptional coactivator YAP1 | G3UY62 | |
MOUSE | Yap1 | Uncharacterized protein | Q3U046 | |
MOUSE | Yap1 | Uncharacterized protein | Q3TUW1 | |
MOUSE | 22601 | Yap1 | Transcriptional coactivator YAP1 | P46938 |
RAT | Yap1 | Transcriptional coactivator YAP1 | R9PXS9 | |
RAT | Yap1 | Transcriptional coactivator YAP1 | A0A0G2K0Y6 | |
RAT | 363014 | Yap1 | Transcriptional coactivator YAP1 | Q2EJA0 |
Protein Classes
PANTHER Classes
protein / enzyme modulator / kinase modulator / Transcriptional coactivator YAP1
protein / enzyme modulator / transcription cofactor / Transcriptional coactivator YAP1
protein / enzyme modulator / kinase modulator / Transcriptional coactivator YAP1
protein / enzyme modulator / transcription cofactor / Transcriptional coactivator YAP1
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx