Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Transcriptional coactivator YAP1

Gene ID10413
uniprotP46937
Gene NameYAP1
Ensernbl IDENSP00000478927
FamilyBelongs to the YAP1 family.
Sequence
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN10413YAP1Transcriptional coactivator YAP1P46937
MOUSEYap1Transcriptional coactivator YAP1G3UYA6
MOUSEYap1Transcriptional coactivator YAP1G3UYW7
MOUSEYap1Transcriptional coactivator YAP1G3UYV4
MOUSEYap1Transcriptional coactivator YAP1G3UY62
MOUSEYap1Uncharacterized proteinQ3U046
MOUSEYap1Uncharacterized proteinQ3TUW1
MOUSE22601Yap1Transcriptional coactivator YAP1P46938
RATYap1Transcriptional coactivator YAP1R9PXS9
RATYap1Transcriptional coactivator YAP1A0A0G2K0Y6
RAT363014Yap1Transcriptional coactivator YAP1Q2EJA0

Protein Classes

PANTHER Classes
protein    /    enzyme modulator    /    kinase modulator    /    Transcriptional coactivator YAP1
protein    /    enzyme modulator    /    transcription cofactor    /    Transcriptional coactivator YAP1
DTO Classes
protein    /    Enzyme modulator    /    Kinase modulator    /    Transcriptional coactivator YAP1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source