JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
UBE2C

UBE2C

Description	Ubiquitin-conjugating enzyme E2 C

Gene and Protein Information

Gene ID	11065
Uniprot Accession IDs	A6NP33 E1P5N7 G3XAB7
Ensembl ID	ENSP00000348838
Symbol	UBCH10 UBCH10 dJ447F3.2
Family	Belongs to the ubiquitin-conjugating enzyme family.
Sequence	MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	709380	UBE2C	ubiquitin conjugating enzyme E2 C	9544		Inparanoid, OMA, EggNOG
Mouse	68612	Ube2c	ubiquitin-conjugating enzyme E2C	10090	MGI:1915862	Inparanoid, OMA, EggNOG
Rat	296368	Ube2c	ubiquitin-conjugating enzyme E2C	10116	RGD:1305382	Inparanoid, OMA, EggNOG
Dog	485898	UBE2C	ubiquitin conjugating enzyme E2 C	9615	VGNC:48049	Inparanoid, OMA, EggNOG
Horse	100056334	UBE2C	ubiquitin conjugating enzyme E2 C	9796	VGNC:24714	Inparanoid, OMA, EggNOG
Cow	506962	UBE2C	ubiquitin conjugating enzyme E2 C	9913	VGNC:36578	Inparanoid, OMA, EggNOG
Pig	100153133	UBE2C	ubiquitin conjugating enzyme E2 C	9823		Inparanoid, OMA, EggNOG
Xenopus	100124324	ube2c	ubiquitin conjugating enzyme E2 C	8364	XB-GENE-971108	Inparanoid, OMA, EggNOG
Fruitfly	44118	vih	vihar	7227	FBgn0264848	Inparanoid, OMA, EggNOG
S.cerevisiae	854517	UBC11	putative E2 ubiquitin-protein ligase UBC11	4932	S000005866	Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]