JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Ubiquitin-conjugating enzyme E2 C

Gene ID	11065
uniprot	O00762
Gene Name	UBE2C
Ensernbl ID	ENSP00000348838
Family	Belongs to the ubiquitin-conjugating enzyme family.
Sequence	MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	11065	UBE2C	Ubiquitin-conjugating enzyme E2 C	O00762
MOUSE		Ube2c	Ubiquitin-conjugating enzyme E2 C	A2A4Z1
MOUSE		Ube2c	Uncharacterized protein	Q3UWQ1
MOUSE	68612	Ube2c	Ubiquitin-conjugating enzyme E2C	A2A4Z0
MOUSE	68612	Ube2c	Ubiquitin-conjugating enzyme E2 C	Q9D1C1
RAT		Ube2c	Ubiquitin-conjugating enzyme E2C	A0A0G2K796
RAT	296368	Ube2c	RCG32249	D3ZUW6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx