JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Thymidylate synthase

Gene ID	7298
uniprot	P04818
Gene Name	TYMS
Ensernbl ID	ENSP00000315644
Family	Belongs to the thymidylate synthase family.
Sequence	MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7298	TYMS	Thymidylate synthase	P04818
MOUSE		Tyms	Tyms protein	Q8VDV6
MOUSE		Tyms	Thymidylate synthase	A0A0G2JGF0
MOUSE		Tyms	Uncharacterized protein	Q8C2R3
MOUSE		Tyms	Thymidylate synthase	D6RCW9
MOUSE		Tyms	Thymidylate synthase	A0A0G2JGG2
MOUSE		Tyms	Thymidylate synthase	A0A0G2JF31
MOUSE		Tyms	Uncharacterized protein	Q8C2H6
MOUSE		Tyms	Uncharacterized protein	Q9D0H1
MOUSE		Tyms	Thymidylate synthase	A0A0G2JF03
MOUSE	22171	Tyms	Thymidylate synthase, isoform CRA_b	Q544L2
MOUSE	22171	Tyms	Thymidylate synthase	P07607
RAT	29261	Tyms	Thymidylate synthase	P45352

Protein Classes

PANTHER Classes
protein / transferase / methyltransferase / Thymidylate synthase

DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Thymidylate synthase

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx