JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

TYMS

Description	Thymidylate synthase

Gene and Protein Information

Gene ID	7298
Uniprot Accession IDs	Q8WYK3 Q8WYK4 TS
Ensembl ID	ENSP00000315644
Symbol	TS TS TMS HST422
Family	Belongs to the thymidylate synthase family.
Sequence	MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	740018	TYMS	thymidylate synthetase	9598	VGNC:5220	Inparanoid, OMA, EggNOG
Macaque	697580	TYMS	thymidylate synthetase	9544		Inparanoid, OMA
Mouse	22171	Tyms	thymidylate synthase	10090	MGI:98878	Inparanoid, OMA, EggNOG
Rat	29261	Tyms	thymidylate synthetase	10116	RGD:3921	Inparanoid, OMA, EggNOG
Dog	607417	TYMS	thymidylate synthetase	9615	VGNC:48025	Inparanoid, OMA, EggNOG
Horse	100060971	TYMS	thymidylate synthetase	9796	VGNC:24689	Inparanoid, OMA, EggNOG
Cow	507631	TYMS	thymidylate synthetase	9913	VGNC:36549	Inparanoid, OMA, EggNOG
Opossum	100013725	TYMS	thymidylate synthetase	13616		OMA, EggNOG
Platypus	100077077	TYMS	thymidylate synthetase	9258		Inparanoid, OMA, EggNOG
Chicken	421060	TYMS	thymidylate synthetase	9031	CGNC:11055	Inparanoid, OMA, EggNOG
Anole lizard	100559060	tyms	thymidylate synthetase	28377		Inparanoid, OMA, EggNOG
Xenopus	780313	tyms	thymidylate synthetase	8364	XB-GENE-1001385	Inparanoid, OMA, EggNOG
Zebrafish	81540	tyms	thymidylate synthetase	7955	ZDB-GENE-040426-59	Inparanoid, OMA, EggNOG
C. elegans	172149	tyms-1	Thymidylate synthase	6239		OMA, EggNOG
Fruitfly	33499	Ts	Thymidylate synthase	7227	FBgn0024920	Inparanoid, EggNOG
S.cerevisiae	854241	CDC21	thymidylate synthase	4932	S000005600	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / transferase / methyltransferase / Thymidylate synthase

DTO Classes
protein / Enzyme / Transferase / Methyltransferase / Thymidylate synthase

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source