JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Sterol 26-hydroxylase, mitochondrial

Gene ID	1593
uniprot	Q02318
Gene Name	CYP27A1
Ensernbl ID	ENSP00000258415
Family	Belongs to the cytochrome P450 family.
Sequence	MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	1593	CYP27A1	Sterol 26-hydroxylase, mitochondrial	Q02318
MOUSE	104086	Cyp27a1	Sterol 26-hydroxylase, mitochondrial	Q9DBG1
MOUSE		Cyp27a1	Cyp27a1 protein	Q99LX3
RAT	301517	Cyp27a1	Sterol 26-hydroxylase, mitochondrial	P17178
RAT		Cyp27a1	RCG24013, isoform CRA_a	A0A0H2UHN7

Protein Classes

PANTHER Classes
protein / oxidoreductase / oxygenase / Sterol 26-hydroxylase, mitochondrial

DTO Classes
protein / Enzyme / Oxidoreductase / Oxygenase / Sterol 26-hydroxylase, mitochondrial

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx