The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 102723996 |
|---|
| Uniprot Accession IDs | A8MUZ1 Q9HD18 Q9NRQ1 |
|---|
| Ensembl ID | ENSP00000483732 |
|---|
| Symbol | B7H2 B7RP1 ICOSL KIAA0653 |
|---|
| Family | Belongs to the immunoglobulin superfamily. BTN/MOG family. |
|---|
| Sequence | MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 474132 | ICOSLG | inducible T-cell costimulator ligand | 9598 | | OMA, EggNOG |
| Macaque | 722191 | ICOSLG | inducible T-cell costimulator ligand | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 50723 | Icosl | icos ligand | 10090 | MGI:1354701 | Inparanoid, EggNOG |
| Rat | 499415 | Icoslg | inducible T-cell co-stimulator ligand | 10116 | RGD:1562791 | Inparanoid, EggNOG |
| Dog | 487793 | ICOSLG | inducible T-cell costimulator ligand | 9615 | | Inparanoid, EggNOG |
| Cow | 507857 | ICOSLG | inducible T-cell costimulator ligand | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100621467 | ICOSLG | inducible T-cell costimulator ligand | 9823 | | OMA, EggNOG |
| Anole lizard | 103278357 | icoslg | inducible T-cell costimulator ligand | 28377 | | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
