JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

ICOS ligand

Gene ID	102723996
uniprot	O75144
Gene Name	ICOSLG
Ensernbl ID	ENSP00000483732
Family	Belongs to the immunoglobulin superfamily. BTN/MOG family.
Sequence	MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	102723996	ICOSLG	ICOS ligand	O75144
MOUSE	50723	Icoslg	ICOS ligand	Q9JHJ8
RAT	499415	Icoslg	Inducible T-cell co-stimulator ligand	F1LVL2

Protein Classes

PANTHER Classes
protein / protease inhibitor / ICOS ligand

DTO Classes
protein / Enzyme modulator / Protease inhibitor / ICOS ligand

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx