The store will not work correctly when cookies are disabled.
Protein or Target Summary
Inducible T-cell costimulator
| Gene ID | 29851 |
|---|
| uniprot | Q9Y6W8 |
|---|
| Gene Name | ICOS |
|---|
| Ensernbl ID | ENSP00000319476 |
|---|
| Sequence | MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 29851 | ICOS | Inducible T-cell costimulator | Q9Y6W8 |
| MOUSE | | Icos | Inducible T-cell co-stimulator | A2A6A7 |
| MOUSE | 54167 | Icos | Uncharacterized protein | Q3V3X2 |
| MOUSE | | Icos | Inducible T-cell co-stimulator | D0E8G6 |
| MOUSE | | Icos | Inducible T-cell co-stimulator | A2A6A6 |
| MOUSE | | Icos | Inducible T-cell costimulator | Q5SUZ8 |
| MOUSE | 54167 | Icos | Inducible T-cell co-stimulator | Q5SUZ7 |
| MOUSE | 54167 | Icos | Inducible T-cell costimulator | Q9WVS0 |
| RAT | | Icos | Inducible T-cell costimulator | A0A0G2JZC0 |
| RAT | 64545 | Icos | Inducible T-cell costimulator | Q9R1T7 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
