JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Centrosomal protein of 57 kDa

Gene ID	9702
uniprot	Q86XR8
Gene Name	CEP57
Ensernbl ID	ENSP00000317902
Family	Belongs to the translokin family.
Sequence	MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9702	CEP57	Centrosomal protein of 57 kDa	Q86XR8
MOUSE		Cep57	Cep57 protein	A0PJD7
MOUSE		Cep57	Centrosomal protein of 57 kDa	D6RDE1
MOUSE		Cep57	Centrosomal protein of 57 kDa	F7BGJ9
MOUSE		Cep57	Centrosomal protein of 57 kDa	D6RH89
MOUSE	74360	Cep57	Centrosomal protein of 57 kDa	B8JJE7
MOUSE		Cep57	Centrosomal protein of 57 kDa	D6RDR1
MOUSE		Cep57	Centrosomal protein of 57 kDa	B8JJF0
MOUSE	74360	Cep57	Centrosomal protein of 57 kDa	Q8CEE0
RAT	315423	Cep57	Centrosomal protein of 57 kDa	B4F7A7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx