JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Targets(Human)
ID1

ID1

Description	DNA-binding protein inhibitor ID-1

Gene and Protein Information

Gene ID	3397
Uniprot Accession IDs	A8K537 E1P5L4 O00651 O00652 Q16371 Q16377 Q5TE66 Q5TE67 Q969Z7 Q9H0Z5 Q9H109
Ensembl ID	ENSP00000365280
Symbol	BHLHB24 ID ID bHLHb24
Sequence	MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	469912	ID1	inhibitor of DNA binding 1, HLH protein	9598	VGNC:9871	OMA, EggNOG
Macaque	713160	ID1	inhibitor of DNA binding 1, HLH protein	9544		Inparanoid, OMA, EggNOG
Mouse	15901	Id1	inhibitor of DNA binding 1	10090	MGI:96396	Inparanoid, OMA, EggNOG
Rat	25261	Id1	inhibitor of DNA binding 1, HLH protein	10116	RGD:2858	Inparanoid, OMA, EggNOG
Horse	100068419	ID1	inhibitor of DNA binding 1, HLH protein	9796	VGNC:18934	Inparanoid, OMA, EggNOG
Cow	497011	ID1	inhibitor of DNA binding 1, HLH protein	9913	VGNC:30031	Inparanoid, OMA, EggNOG
Opossum	100010733	ID1	inhibitor of DNA binding 1, HLH protein	13616		Inparanoid, EggNOG
Zebrafish	30493	id1	inhibitor of DNA binding 1	7955	ZDB-GENE-990415-96	Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein / transcription factor / DNA-binding protein inhibitor ID-1

DTO Classes
protein / Transcription factor / DNA-binding protein inhibitor ID-1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source