ID1

DescriptionDNA-binding protein inhibitor ID-1

Gene and Protein Information

Gene ID3397
Uniprot Accession IDs A8K537 E1P5L4 O00651 O00652 Q16371 Q16377 Q5TE66 Q5TE67 Q969Z7 Q9H0Z5 Q9H109
Ensembl ID ENSP00000365280
Symbol BHLHB24 ID ID bHLHb24
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469912ID1inhibitor of DNA binding 1, HLH protein9598VGNC:9871OMA, EggNOG
Macaque713160ID1inhibitor of DNA binding 1, HLH protein9544Inparanoid, OMA, EggNOG
Mouse15901Id1inhibitor of DNA binding 110090MGI:96396Inparanoid, OMA, EggNOG
Rat25261Id1inhibitor of DNA binding 1, HLH protein10116RGD:2858Inparanoid, OMA, EggNOG
Horse100068419ID1inhibitor of DNA binding 1, HLH protein9796VGNC:18934Inparanoid, OMA, EggNOG
Cow497011ID1inhibitor of DNA binding 1, HLH protein9913VGNC:30031Inparanoid, OMA, EggNOG
Opossum100010733ID1inhibitor of DNA binding 1, HLH protein13616Inparanoid, EggNOG
Zebrafish30493id1inhibitor of DNA binding 17955ZDB-GENE-990415-96Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    DNA-binding protein inhibitor ID-1
DTO Classes
protein    /    Transcription factor    /    DNA-binding protein inhibitor ID-1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source