Protein or Target Summary
Interleukin-3 receptor subunit alpha
| Gene ID | 3563 |
|---|---|
| uniprot | P26951 |
| Gene Name | IL3RA |
| Ensernbl ID | ENSP00000327890 |
| Family | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
| Sequence | MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 3563 | IL3RA | Interleukin-3 receptor subunit alpha | P26951 |
| MOUSE | Il3ra | Interleukin-3 receptor subunit alpha | A0A286YE23 | |
| MOUSE | Il3ra | Interleukin-3 receptor subunit alpha | A0A286YE20 | |
| MOUSE | 16188 | Il3ra | Interleukin-3 receptor subunit alpha | P26952 |
| RAT | 246144 | Il3ra | Interleukin 3 receptor subunit alpha | E9PSX4 |
Protein Classes
PANTHER Classes
protein / signaling molecule / defense/immunity protein / Interleukin-3 receptor subunit alpha
protein / signaling molecule / cytokine / Interleukin-3 receptor subunit alpha
protein / signaling molecule / defense/immunity protein / Interleukin-3 receptor subunit alpha
protein / signaling molecule / cytokine / Interleukin-3 receptor subunit alpha
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx