The store will not work correctly when cookies are disabled.
IL3RA
Description | Interleukin-3 receptor subunit alpha |
---|
Gene and Protein Information
Gene ID | 3563 |
Uniprot Accession IDs | A8K3F3 B9VI81 Q5HYQ7 Q5HYQ8 Q9UEH7 IL-3 receptor subunit alpha |
Ensembl ID | ENSP00000327890 |
Symbol | IL3R IL3R CD123 IL3RX IL3RY IL3RAY hIL-3Ra |
Family | Belongs to the type I cytokine receptor family. Type 5 subfamily. |
Sequence | MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Mouse | 16188 | Il3ra | interleukin 3 receptor, alpha chain | 10090 | MGI:96553 | Inparanoid, OMA, EggNOG |
Rat | 246144 | Il3ra | interleukin 3 receptor subunit alpha | 10116 | RGD:628728 | Inparanoid, OMA, EggNOG |
Dog | 609293 | IL3RA | interleukin 3 receptor subunit alpha | 9615 | | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|