IL1B

DescriptionInterleukin-1 beta

Gene and Protein Information

Gene ID3553
Uniprot Accession IDs Q53X59 Q53XX2 Q7M4S7 Q7RU01 Q96HE5 Q9UCT6 IL-1 beta
Ensembl ID ENSP00000263341
Symbol IL1F2 IL-1 IL1F2 IL1-BETA
FamilyBelongs to the IL-1 family.
Sequence
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
SpeciesGene IDGene SymbolGene NameUniprot
HUMAN3553IL1BInterleukin-1 betaP01584
MOUSEIl1bInterleukin-1 betaQ3TI17
MOUSE16176Il1bInterleukin-1 betaP10749
RAT24494Il1bMultifunctional fusion proteinQ5BKB0
RATIl1bInterleukin-1 betaQ63264

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source