JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
IL1B

IL1B

Description	Interleukin-1 beta

Gene and Protein Information

Gene ID	3553
Uniprot Accession IDs	Q53X59 Q53XX2 Q7M4S7 Q7RU01 Q96HE5 Q9UCT6 IL-1 beta
Ensembl ID	ENSP00000263341
Symbol	IL1F2 IL-1 IL1F2 IL1-BETA
Family	Belongs to the IL-1 family.
Sequence	MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	450200	IL1B	interleukin 1 beta	9598	VGNC:1940	OMA, EggNOG
Mouse	16176	Il1b	interleukin 1 beta	10090	MGI:96543	Inparanoid, OMA, EggNOG
Rat	24494	Il1b	interleukin 1 beta	10116	RGD:2891	Inparanoid, OMA, EggNOG
Dog	403974	IL1B	interleukin 1 beta	9615	VGNC:41957	Inparanoid, OMA, EggNOG
Cow	281251	IL1B	interleukin 1 beta	9913	VGNC:52787	Inparanoid, OMA, EggNOG
Pig	110258578	LOC110258578	interleukin-1 beta-like	9823		OMA, EggNOG
Opossum	100026024	IL1B	interleukin 1 beta	13616		Inparanoid, EggNOG
Platypus	103165286	IL1B	interleukin 1 beta	9258		OMA, EggNOG
Xenopus	100487038	il1b	interleukin 1 beta	8364	XB-GENE-481756	Inparanoid, OMA, EggNOG
Zebrafish	405770	il1b	interleukin 1, beta	7955	ZDB-GENE-040702-2	Inparanoid, OMA

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]