The store will not work correctly when cookies are disabled.
Protein or Target Summary
Interferon-induced transmembrane protein 1
| Gene ID | 8519 |
|---|
| uniprot | P13164 |
|---|
| Gene Name | IFITM1 |
|---|
| Ensernbl ID | ENSP00000386187 |
|---|
| Family | Belongs to the CD225/Dispanin family. |
|---|
| Sequence | MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 8519 | IFITM1 | Interferon-induced transmembrane protein 1 | P13164 |
| MOUSE | 68713 | Ifitm1 | Interferon-induced transmembrane protein 1 | Q9D103 |
| RAT | 293618 | Ifitm1 | Interferon-induced transmembrane protein 1 | F1M3Q1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
