The store will not work correctly when cookies are disabled.
IL15
| Description | Interleukin-15 |
|---|
Gene and Protein Information
| Gene ID | 3600 |
|---|
| Uniprot Accession IDs | D3DNZ2 O00440 O43512 Q495Z8 Q6FGX7 Q93058 Q9UBA3 IL-15 |
|---|
| Ensembl ID | ENSP00000296545 |
|---|
| Symbol | IL-15 |
|---|
| Family | Belongs to the IL-15/IL-21 family. |
|---|
| Sequence | MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 737808 | IL15 | interleukin 15 | 9598 | VGNC:753 | OMA, EggNOG |
| Macaque | 699616 | IL15 | interleukin 15 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16168 | Il15 | interleukin 15 | 10090 | MGI:103014 | Inparanoid, OMA, EggNOG |
| Rat | 25670 | Il15 | interleukin 15 | 10116 | RGD:2887 | Inparanoid, OMA, EggNOG |
| Dog | 403584 | IL15 | interleukin 15 | 9615 | VGNC:41939 | Inparanoid, OMA, EggNOG |
| Horse | 100034058 | IL15 | interleukin 15 | 9796 | VGNC:18998 | Inparanoid, OMA, EggNOG |
| Cow | 281248 | IL15 | interleukin 15 | 9913 | VGNC:30116 | Inparanoid, OMA, EggNOG |
| Pig | 397683 | IL15 | interleukin 15 | 9823 | | Inparanoid, OMA |
| Opossum | 103092205 | IL15 | interleukin 15 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100082206 | IL15 | interleukin 15 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 395258 | IL15 | interleukin 15 | 9031 | CGNC:7499 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
