The store will not work correctly when cookies are disabled.
MED4
| Description | Mediator of RNA polymerase II transcription subunit 4 |
|---|
Gene and Protein Information
| Gene ID | 29079 |
|---|
| Uniprot Accession IDs | B4DX67 Q53GB4 Q53H68 Q5T912 Q6FHC4 Q6IA79 Q9BS95 Q9NYR5 |
|---|
| Ensembl ID | ENSP00000258648 |
|---|
| Symbol | ARC36 DRIP36 VDRIP ARC36 VDRIP DRIP36 TRAP36 HSPC126 |
|---|
| Family | Belongs to the Mediator complex subunit 4 family. |
|---|
| Sequence | MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 452713 | MED4 | mediator complex subunit 4 | 9598 | VGNC:5075 | OMA, EggNOG |
| Macaque | 704644 | MED4 | mediator complex subunit 4 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 67381 | Med4 | mediator complex subunit 4 | 10090 | MGI:1914631 | Inparanoid, OMA, EggNOG |
| Rat | 306030 | Med4 | mediator complex subunit 4 | 10116 | RGD:1306671 | Inparanoid, OMA, EggNOG |
| Dog | 476917 | MED4 | mediator complex subunit 4 | 9615 | VGNC:43139 | Inparanoid, OMA, EggNOG |
| Horse | 100050354 | MED4 | mediator complex subunit 4 | 9796 | VGNC:20088 | Inparanoid, OMA, EggNOG |
| Cow | 515299 | MED4 | mediator complex subunit 4 | 9913 | VGNC:31368 | Inparanoid, OMA, EggNOG |
| Opossum | 100022682 | MED4 | mediator complex subunit 4 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100083567 | MED4 | mediator complex subunit 4 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 418859 | MED4 | mediator complex subunit 4 | 9031 | CGNC:12757 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568028 | med4 | mediator complex subunit 4 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 496653 | med4 | mediator complex subunit 4 | 8364 | XB-GENE-972352 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550582 | med4 | mediator complex subunit 4 | 7955 | ZDB-GENE-050417-438 | Inparanoid, OMA |
| Fruitfly | 38799 | MED4 | Mediator complex subunit 4 | 7227 | FBgn0035754 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
