The store will not work correctly when cookies are disabled.
Protein or Target Summary
Mediator of RNA polymerase II transcription subunit 4
| Gene ID | 29079 |
|---|
| uniprot | Q9NPJ6 |
|---|
| Gene Name | MED4 |
|---|
| Ensernbl ID | ENSP00000258648 |
|---|
| Family | Belongs to the Mediator complex subunit 4 family. |
|---|
| Sequence | MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 29079 | MED4 | Mediator of RNA polymerase II transcription subunit 4 | Q9NPJ6 |
| MOUSE | 67381 | Med4 | Mediator of RNA polymerase II transcription subunit 4 | Q9CQA5 |
| RAT | 306030 | Med4 | Mediator of RNA polymerase II transcription subunit 4 | Q561Q8 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
