Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

IL6R

DescriptionInterleukin-6 receptor subunit alpha

Gene and Protein Information

Gene ID3570
Uniprot Accession IDs A8KAE8 B2R6V4 Q16202 Q53EQ7 Q5FWG2 Q5VZ23 IL-6 receptor subunit alpha
Ensembl ID ENSP00000357470
Symbol IL6Q gp80 CD126 IL6RA IL6RQ IL-6RA IL-6R-1
FamilyBelongs to the type I cytokine receptor family. Type 3 subfamily.
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp469506IL6Rinterleukin 6 receptor9598VGNC:1271OMA, EggNOG
Macaque716690IL6Rinterleukin 6 receptor9544Inparanoid, OMA, EggNOG
Mouse16194Il6rainterleukin 6 receptor, alpha10090MGI:105304Inparanoid, OMA, EggNOG
Rat24499Il6rinterleukin 6 receptor10116RGD:2902Inparanoid, OMA, EggNOG
Dog612271IL6Rinterleukin 6 receptor9615VGNC:41993Inparanoid, OMA, EggNOG
Horse102148787IL6Rinterleukin 6 receptor9796VGNC:19035Inparanoid, OMA, EggNOG
Cow507359IL6Rinterleukin 6 receptor9913VGNC:30167Inparanoid, OMA, EggNOG
Pig399522IL6Rinterleukin 6 receptor9823Inparanoid, EggNOG
Opossum100020561IL6Rinterleukin 6 receptor13616OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    defense/immunity protein    /    Interleukin-6 receptor subunit alpha
protein    /    signaling molecule    /    cytokine    /    Interleukin-6 receptor subunit alpha
DTO Classes
protein    /    Signaling    /    Cytokine    /    Interleukin-6 receptor subunit alpha

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.