The store will not work correctly when cookies are disabled.
IL6R
| Description | Interleukin-6 receptor subunit alpha |
|---|
Gene and Protein Information
| Gene ID | 3570 |
|---|
| Uniprot Accession IDs | A8KAE8 B2R6V4 Q16202 Q53EQ7 Q5FWG2 Q5VZ23 IL-6 receptor subunit alpha |
|---|
| Ensembl ID | ENSP00000357470 |
|---|
| Symbol | IL6Q gp80 CD126 IL6RA IL6RQ IL-6RA IL-6R-1 |
|---|
| Family | Belongs to the type I cytokine receptor family. Type 3 subfamily. |
|---|
| Sequence | MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 469506 | IL6R | interleukin 6 receptor | 9598 | VGNC:1271 | OMA, EggNOG |
| Macaque | 716690 | IL6R | interleukin 6 receptor | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16194 | Il6ra | interleukin 6 receptor, alpha | 10090 | MGI:105304 | Inparanoid, OMA, EggNOG |
| Rat | 24499 | Il6r | interleukin 6 receptor | 10116 | RGD:2902 | Inparanoid, OMA, EggNOG |
| Dog | 612271 | IL6R | interleukin 6 receptor | 9615 | VGNC:41993 | Inparanoid, OMA, EggNOG |
| Horse | 102148787 | IL6R | interleukin 6 receptor | 9796 | VGNC:19035 | Inparanoid, OMA, EggNOG |
| Cow | 507359 | IL6R | interleukin 6 receptor | 9913 | VGNC:30167 | Inparanoid, OMA, EggNOG |
| Pig | 399522 | IL6R | interleukin 6 receptor | 9823 | | Inparanoid, EggNOG |
| Opossum | 100020561 | IL6R | interleukin 6 receptor | 13616 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
