The store will not work correctly when cookies are disabled.
IFITM3
| Description | Interferon-induced transmembrane protein 3 |
|---|
Gene and Protein Information
| Gene ID | 10410 |
|---|
| Uniprot Accession IDs | Q53Y76 Q96HK8 Q96J15 |
|---|
| Ensembl ID | ENSP00000382707 |
|---|
| Symbol | 1-8U IP15 DSPA2b |
|---|
| Family | Belongs to the CD225/Dispanin family. |
|---|
| Sequence | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 738726 | IFITM3 | interferon induced transmembrane protein 3 | 9598 | VGNC:1065 | Inparanoid, OMA, EggNOG |
| Macaque | 696527 | LOC696527 | interferon-induced transmembrane protein 3 | 9544 | | OMA, EggNOG |
| Mouse | 80876 | Ifitm2 | interferon induced transmembrane protein 2 | 10090 | MGI:1933382 | OMA, EggNOG |
| Rat | 361673 | Ifitm3 | interferon induced transmembrane protein 3 | 10116 | RGD:1595844 | OMA, EggNOG |
| Dog | 475935 | LOC475935 | interferon-induced transmembrane protein 1-like | 9615 | | OMA, EggNOG |
| Horse | 100050797 | LOC100050797 | interferon-induced transmembrane protein 1-like | 9796 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
