The store will not work correctly when cookies are disabled.
IL11
| Description | Interleukin-11 |
|---|
Gene and Protein Information
| Gene ID | 3589 |
|---|
| Uniprot Accession IDs | B4DQV5 Q96EB4 IL-11 |
|---|
| Ensembl ID | ENSP00000264563 |
|---|
| Symbol | AGIF IL-11 |
|---|
| Family | Belongs to the IL-6 superfamily. |
|---|
| Sequence | MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 736204 | IL11 | interleukin 11 | 9598 | VGNC:2344 | OMA, EggNOG |
| Mouse | 16156 | Il11 | interleukin 11 | 10090 | MGI:107613 | Inparanoid, OMA, EggNOG |
| Rat | 171040 | Il11 | interleukin 11 | 10116 | RGD:621475 | Inparanoid, OMA, EggNOG |
| Dog | 611309 | IL11 | interleukin 11 | 9615 | VGNC:41930 | Inparanoid, OMA, EggNOG |
| Horse | 100056037 | IL11 | interleukin 11 | 9796 | VGNC:18993 | Inparanoid, OMA, EggNOG |
| Cow | 100337295 | IL11 | interleukin 11 | 9913 | VGNC:30108 | Inparanoid, OMA, EggNOG |
| Anole lizard | 103279929 | il11 | interleukin 11 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 105947927 | il11 | interleukin 11 | 8364 | XB-GENE-479735 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
