Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

IL17A

DescriptionInterleukin-17A

Gene and Protein Information

Gene ID3605
Uniprot Accession IDs Q5T2P0 IL-17
Ensembl ID ENSP00000344192
Symbol CTLA8 IL17 IL17 CTLA8 IL-17 CTLA-8 IL-17A
FamilyBelongs to the IL-17 family.
Sequence
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp472029IL17Ainterleukin 17A9598VGNC:3123OMA, EggNOG
Macaque708123IL17Ainterleukin 17A9544Inparanoid, OMA, EggNOG
Mouse16171Il17ainterleukin 17A10090MGI:107364Inparanoid, OMA, EggNOG
Rat301289Il17ainterleukin 17A10116RGD:2888Inparanoid, OMA, EggNOG
Dog481837IL17Ainterleukin 17A9615VGNC:41942OMA, EggNOG
Horse100034142IL17Ainterleukin 17A9796VGNC:19000OMA, EggNOG
Cow282863IL17Ainterleukin 17A9913VGNC:30117Inparanoid, OMA, EggNOG
Pig449530IL17Ainterleukin 17A9823Inparanoid, OMA, EggNOG
Opossum100016267IL17Ainterleukin 17A13616Inparanoid, OMA, EggNOG
Platypus100078889IL17Ainterleukin 17A9258Inparanoid, OMA, EggNOG
Chicken428665IL17Finterleukin 17F9031CGNC:53428Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

The page will load shortly, Thanks for your patience!
NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Bibliography

      1.Kotake, S S and 11 more authors. 1999-05 IL-17 in synovial fluids from patients with rheumatoid arthritis is a potent stimulator of osteoclastogenesis. [PMID:10225978]
      2.Shin, H C HC, Benbernou, N N, Esnault, S S and Guenounou, M M. 1999-04 Expression of IL-17 in human memory CD45RO+ T lymphocytes and its regulation by protein kinase A pathway. [PMID:10328864]
      3.Andoh, A A and 10 more authors. 2001-07 Cooperation of interleukin-17 and interferon-gamma on chemokine secretion in human fetal intestinal epithelial cells. [PMID:11472426]
      4.Laan, M M, Palmberg, L L, Larsson, K K and Lindén, A A. 2002-03 Free, soluble interleukin-17 protein during severe inflammation in human airways. [PMID:11936535]
      5.Andoh, Akira A and 6 more authors. 2002-08-15 IL-17 selectively down-regulates TNF-alpha-induced RANTES gene expression in human colonic subepithelial myofibroblasts. [PMID:12165487]
      6.Andoh, Akira A and 6 more authors. 2002-08-19 Extracellular signal-regulated kinases 1 and 2 participate in interleukin-17 plus tumor necrosis factor-alpha-induced stabilization of interleukin-6 mRNA in human pancreatic myofibroblasts. [PMID:12183057]
      7.Hsieh, Hsian-Guey HG, Loong, Che-Chang CC and Lin, Ching-Yuang CY. 2002-08-21 Interleukin-17 induces src/MAPK cascades activation in human renal epithelial cells. [PMID:12297109]
      8.Aggarwal, Sudeepta S, Ghilardi, Nico N, Xie, Ming-Hong MH, de Sauvage, Frederic J FJ and Gurney, Austin L AL. 2003-01-17 Interleukin-23 promotes a distinct CD4 T cell activation state characterized by the production of interleukin-17. [PMID:12417590]
      9.Maertzdorf, Jeroen J, Osterhaus, Albert D M E AD and Verjans, Georges M G M GM. 2002-11-15 IL-17 expression in human herpetic stromal keratitis: modulatory effects on chemokine production by corneal fibroblasts. [PMID:12421973]
      10.Strausberg, Robert L RL and 83 more authors. 2002-12-24 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. [PMID:12477932]