Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Interferon gamma

Gene ID3458
uniprotP01579
Gene NameIFNG
Ensernbl IDENSP00000229135
FamilyBelongs to the type II (or gamma) interferon family.
Sequence
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN3458IFNGInterferon gammaP01579
MOUSEIfngInterferon gammaQ6TDH0
MOUSEIfngInterferon gammaC4NUM1
MOUSEIfngInterferon gammaA3RL32
MOUSEIfngInterferon gammaC4NUL9
MOUSE15978IfngInterferon gammaP01580
RAT25712IfngInterferon gammaP01581

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source