The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
IFNG
Description | Interferon gamma |
---|
Gene and Protein Information
Gene ID | 3458 |
Uniprot Accession IDs | P01579 B5BU88 Q53ZV4 IFN-gamma |
Ensembl ID | ENSP00000229135 |
Symbol | IFG IFI |
Family | Belongs to the type II (or gamma) interferon family. |
Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 449517 | IFNG | interferon gamma | 9598 | | Inparanoid, OMA, EggNOG |
Macaque | 574282 | IFNG | interferon gamma | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 15978 | Ifng | interferon gamma | 10090 | MGI:107656 | Inparanoid, OMA, EggNOG |
Rat | 25712 | Ifng | interferon gamma | 10116 | RGD:2866 | Inparanoid, OMA, EggNOG |
Dog | 403801 | IFNG | interferon gamma | 9615 | VGNC:41879 | Inparanoid, OMA, EggNOG |
Horse | 100034181 | IFNG | interferon gamma | 9796 | VGNC:18951 | Inparanoid, OMA, EggNOG |
Cow | 281237 | IFNG | interferon gamma | 9913 | VGNC:30057 | Inparanoid, OMA, EggNOG |
Platypus | 100080275 | IFNG | interferon gamma | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 396054 | IFNG | interferon gamma | 9031 | CGNC:7521 | Inparanoid, OMA, EggNOG |
Xenopus | 100216446 | ifng | interferon, gamma | 8364 | XB-GENE-488149 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!