The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
IFNG
| Description | Interferon gamma |
|---|
Gene and Protein Information
| Gene ID | 3458 |
|---|
| Uniprot Accession IDs | P01579 B5BU88 Q53ZV4 IFN-gamma |
|---|
| Ensembl ID | ENSP00000229135 |
|---|
| Symbol | IFG IFI |
|---|
| Family | Belongs to the type II (or gamma) interferon family. |
|---|
| Sequence | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 449517 | IFNG | interferon gamma | 9598 | | Inparanoid, OMA, EggNOG |
| Macaque | 574282 | IFNG | interferon gamma | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 15978 | Ifng | interferon gamma | 10090 | MGI:107656 | Inparanoid, OMA, EggNOG |
| Rat | 25712 | Ifng | interferon gamma | 10116 | RGD:2866 | Inparanoid, OMA, EggNOG |
| Dog | 403801 | IFNG | interferon gamma | 9615 | VGNC:41879 | Inparanoid, OMA, EggNOG |
| Horse | 100034181 | IFNG | interferon gamma | 9796 | VGNC:18951 | Inparanoid, OMA, EggNOG |
| Cow | 281237 | IFNG | interferon gamma | 9913 | VGNC:30057 | Inparanoid, OMA, EggNOG |
| Platypus | 100080275 | IFNG | interferon gamma | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 396054 | IFNG | interferon gamma | 9031 | CGNC:7521 | Inparanoid, OMA, EggNOG |
| Xenopus | 100216446 | ifng | interferon, gamma | 8364 | XB-GENE-488149 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!
