The store will not work correctly when cookies are disabled.
IGF1
| Description | Insulin-like growth factor I |
|---|
Gene and Protein Information
| Gene ID | 3479 |
|---|
| Uniprot Accession IDs | B2RWM7 E9PD02 P01343 Q14620 IGF-I |
|---|
| Ensembl ID | ENSP00000302665 |
|---|
| Symbol | IBP1 IGF MGF IGFI IGF-I |
|---|
| Family | Belongs to the insulin family. |
|---|
| Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 741055 | IGF1 | insulin like growth factor 1 | 9598 | VGNC:5427 | OMA, EggNOG |
| Macaque | 698444 | IGF1 | insulin like growth factor 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 16000 | Igf1 | insulin-like growth factor 1 | 10090 | MGI:96432 | Inparanoid, OMA, EggNOG |
| Rat | 24482 | Igf1 | insulin-like growth factor 1 | 10116 | RGD:2868 | Inparanoid, OMA, EggNOG |
| Dog | 610255 | IGF1 | insulin like growth factor 1 | 9615 | VGNC:41895 | Inparanoid, OMA, EggNOG |
| Horse | 100034198 | IGF1 | insulin like growth factor 1 | 9796 | VGNC:18967 | Inparanoid, OMA, EggNOG |
| Cow | 281239 | IGF1 | insulin like growth factor 1 | 9913 | VGNC:30076 | Inparanoid, OMA, EggNOG |
| Pig | 397491 | IGF1 | insulin like growth factor 1 | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100021295 | IGF1 | insulin like growth factor 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100075905 | IGF1 | insulin like growth factor 1 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 418090 | IGF1 | insulin like growth factor 1 | 9031 | CGNC:9671 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100566682 | igf1 | insulin like growth factor 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100486334 | igf1 | insulin like growth factor 1 | 8364 | XB-GENE-480239 | Inparanoid, OMA, EggNOG |
| Zebrafish | 114433 | igf1 | insulin-like growth factor 1 | 7955 | ZDB-GENE-010607-2 | Inparanoid, OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
