The store will not work correctly when cookies are disabled.
IGF1
Description | Insulin-like growth factor I |
---|
Gene and Protein Information
Gene ID | 3479 |
Uniprot Accession IDs | B2RWM7 E9PD02 P01343 Q14620 IGF-I |
Ensembl ID | ENSP00000302665 |
Symbol | IBP1 IGF MGF IGFI IGF-I |
Family | Belongs to the insulin family. |
Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK |
---|
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 3479 | IGF1 | Insulin-like growth factor I | P05019 |
MOUSE | | Igf1 | Insulin-like growth factor 1 | Q547V2 |
MOUSE | | Igf1 | Insulin-like growth factor I | D3Z7M4 |
MOUSE | 16000 | Igf1 | Insulin-like growth factor I | E9PU89 |
MOUSE | 16000 | Igf1 | Insulin-like growth factor 1 isoform Eb | Q4VJB9 |
MOUSE | 16000 | Igf1 | Insulin-like growth factor I | Q8CAR0 |
MOUSE | 16000 | Igf1 | Insulin-like growth factor 1 isoform Ea | Q4VJC0 |
MOUSE | 16000 | Igf1 | Insulin-like growth factor I | E9Q138 |
MOUSE | 16000 | Igf1 | Insulin-like growth factor I | P05017 |
RAT | 24482 | Igf1 | Insulin-like growth factor 1, isoform CRA_b | F8WFZ5 |
RAT | 24482 | Igf1 | Igf1 protein | Q5RK13 |
RAT | 24482 | Igf1 | Rat pre-pro-insulin-like growth factor | Q63261 |
RAT | 24482 | Igf1 | Insulin-like growth factor I | A0A0G2JX40 |
RAT | 24482 | Igf1 | Insulin-like growth factor I | P08025 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|