The store will not work correctly when cookies are disabled.
Protein or Target Summary
Immunoglobulin lambda constant 1
| Gene ID | 3537 |
|---|
| uniprot | P0CG04 |
|---|
| Gene Name | IGLC1 |
|---|
| Ensernbl ID | ENSP00000431254 |
|---|
| Sequence | GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 3537 | IGLC1 | Immunoglobulin lambda constant 1 | P0CG04 |
| MOUSE | | Iglc1 | Immunoglobulin lambda constant 1 | A0A0G2JE99 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
