The store will not work correctly when cookies are disabled.
FOS
| Description | Proto-oncogene c-Fos |
|---|
Gene and Protein Information
| Gene ID | 2353 |
|---|
| Uniprot Accession IDs | A8K4E2 B4DQ65 P18849 |
|---|
| Ensembl ID | ENSP00000306245 |
|---|
| Symbol | G0S7 p55 AP-1 C-FOS |
|---|
| Family | Belongs to the bZIP family. Fos subfamily. |
|---|
| Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 14281 | Fos | FBJ osteosarcoma oncogene | 10090 | MGI:95574 | Inparanoid, OMA, EggNOG |
| Rat | 314322 | Fos | Fos proto-oncogene, AP-1 transcription factor subunit | 10116 | RGD:2626 | Inparanoid, OMA, EggNOG |
| Dog | 490792 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9615 | VGNC:40940 | Inparanoid, OMA, EggNOG |
| Horse | 100051632 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9796 | VGNC:18095 | Inparanoid, OMA, EggNOG |
| Cow | 280795 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9913 | VGNC:29073 | Inparanoid, OMA, EggNOG |
| Pig | 100144486 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100018285 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 13616 | | Inparanoid, EggNOG |
| Platypus | 100075021 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 396512 | FOS | Fos proto-oncogene, AP-1 transcription factor subunit | 9031 | CGNC:49845 | Inparanoid, OMA |
| Anole lizard | 100556427 | fos | Fos proto-oncogene, AP-1 transcription factor subunit | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548954 | fos | FBJ murine osteosarcoma viral oncogene homolog | 8364 | XB-GENE-866811 | Inparanoid, OMA, EggNOG |
| Zebrafish | 394198 | fosab | v-fos FBJ murine osteosarcoma viral oncogene homolog Ab | 7955 | ZDB-GENE-031222-4 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
