The store will not work correctly when cookies are disabled.
Protein or Target Summary
Proto-oncogene c-Fos
| Gene ID | 2353 |
|---|
| uniprot | P01100 |
|---|
| Gene Name | FOS |
|---|
| Ensernbl ID | ENSP00000306245 |
|---|
| Family | Belongs to the bZIP family. Fos subfamily. |
|---|
| Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2353 | FOS | Proto-oncogene c-Fos | P01100 |
| MOUSE | | Fos | Uncharacterized protein | Q3U463 |
| MOUSE | | Fos | FBJ osteosarcoma oncogene | Q6TDG4 |
| MOUSE | 14281 | Fos | Proto-oncogene c-Fos | P01101 |
| RAT | | Fos | Proto-oncogene c-FOS | Q5U875 |
| RAT | | Fos | Proto-oncogene c-FOS | Q5U874 |
| RAT | | Fos | Proto-oncogene c-FOS | Q5U873 |
| RAT | 314322 | Fos | Proto-oncogene c-Fos | P12841 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
