The store will not work correctly when cookies are disabled.
Protein or Target Summary
Proto-oncogene c-Fos
Gene ID | 2353 |
uniprot | P01100 |
Gene Name | FOS |
Ensernbl ID | ENSP00000306245 |
Family | Belongs to the bZIP family. Fos subfamily. |
Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 2353 | FOS | Proto-oncogene c-Fos | P01100 |
MOUSE | | Fos | Uncharacterized protein | Q3U463 |
MOUSE | | Fos | FBJ osteosarcoma oncogene | Q6TDG4 |
MOUSE | 14281 | Fos | Proto-oncogene c-Fos | P01101 |
RAT | | Fos | Proto-oncogene c-FOS | Q5U875 |
RAT | | Fos | Proto-oncogene c-FOS | Q5U874 |
RAT | | Fos | Proto-oncogene c-FOS | Q5U873 |
RAT | 314322 | Fos | Proto-oncogene c-Fos | P12841 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|