The store will not work correctly when cookies are disabled.
FSHB
Description | Follitropin subunit beta |
---|
Gene and Protein Information
Gene ID | 2488 |
Uniprot Accession IDs | A2TF08 A5JVV3 Q14D61 |
Ensembl ID | ENSP00000416606 |
Symbol | HH24 |
Family | Belongs to the glycoprotein hormones subunit beta family. |
Sequence | MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 736618 | FSHB | follicle stimulating hormone subunit beta | 9598 | VGNC:6558 | Inparanoid, OMA, EggNOG |
Mouse | 14308 | Fshb | follicle stimulating hormone beta | 10090 | MGI:95582 | Inparanoid, OMA, EggNOG |
Rat | 25447 | Fshb | follicle stimulating hormone subunit beta | 10116 | RGD:2630 | Inparanoid, OMA, EggNOG |
Dog | 485428 | FSHB | follicle stimulating hormone subunit beta | 9615 | VGNC:40996 | Inparanoid, OMA, EggNOG |
Horse | 100033829 | FSHB | follicle stimulating hormone beta subunit | 9796 | | Inparanoid, OMA, EggNOG |
Cow | 281171 | FSHB | follicle stimulating hormone beta subunit | 9913 | | Inparanoid, OMA, EggNOG |
Pig | 396895 | FSHB | follicle stimulating hormone beta subunit | 9823 | | Inparanoid, OMA, EggNOG |
Opossum | 554190 | FSHB | follicle stimulating hormone beta subunit | 13616 | | Inparanoid, OMA, EggNOG |
Platypus | 100073363 | FSHB | follicle stimulating hormone beta subunit | 9258 | | Inparanoid, OMA, EggNOG |
Chicken | 374108 | FSHB | follicle stimulating hormone beta subunit | 9031 | CGNC:9209 | OMA, EggNOG |
Anole lizard | 100568157 | fshb | follicle stimulating hormone beta subunit | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100495812 | fshb | follicle stimulating hormone subunit beta | 8364 | XB-GENE-484695 | Inparanoid, OMA, EggNOG |
Zebrafish | 402919 | fshb | follicle stimulating hormone subunit beta | 7955 | ZDB-GENE-040806-1 | OMA, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|