The store will not work correctly when cookies are disabled.
GALE
| Description | UDP-glucose 4-epimerase |
|---|
Gene and Protein Information
| Gene ID | 2582 |
|---|
| Uniprot Accession IDs | A0A024RAH5 B3KQ39 Q38G75 Q86W41 Q9BVE3 Q9UJB4 |
|---|
| Ensembl ID | ENSP00000483375 |
|---|
| Symbol | SDR1E1 |
|---|
| Family | Belongs to the NAD(P)-dependent epimerase/dehydratase family. |
|---|
| Sequence | MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 456623 | GALE | UDP-galactose-4-epimerase | 9598 | VGNC:11436 | OMA, EggNOG |
| Macaque | 710553 | GALE | UDP-galactose-4-epimerase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 74246 | Gale | galactose-4-epimerase, UDP | 10090 | MGI:1921496 | Inparanoid, OMA, EggNOG |
| Rat | 114860 | Gale | UDP-galactose-4-epimerase | 10116 | RGD:621493 | Inparanoid, OMA |
| Dog | 100855555 | GALE | UDP-galactose-4-epimerase | 9615 | VGNC:41080 | Inparanoid, OMA, EggNOG |
| Horse | 100057723 | GALE | UDP-galactose-4-epimerase | 9796 | VGNC:18218 | Inparanoid, OMA, EggNOG |
| Cow | 523154 | GALE | UDP-galactose-4-epimerase | 9913 | VGNC:29218 | Inparanoid, OMA, EggNOG |
| Pig | 100621392 | GALE | UDP-galactose-4-epimerase | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100010009 | GALE | UDP-galactose-4-epimerase | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 419686 | GALE | UDP-galactose-4-epimerase | 9031 | CGNC:2971 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562252 | gale | UDP-galactose-4-epimerase | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448443 | gale | UDP-galactose-4-epimerase | 8364 | XB-GENE-965029 | Inparanoid, OMA, EggNOG |
| Zebrafish | 678540 | gale | UDP-galactose-4-epimerase | 7955 | ZDB-GENE-060421-6479 | Inparanoid, OMA, EggNOG |
| C. elegans | 173171 | gale-1 | UDP-GALactose 4-Epimerase | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 38076 | Gale | UDP-galactose 4'-epimerase | 7227 | FBgn0035147 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
