Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

FFAR2

DescriptionFree fatty acid receptor 2

Gene and Protein Information

Gene ID2867
Uniprot Accession IDs B0M0J9 Q4VAZ3 Q4VAZ5 Q4VBL5
Ensembl ID ENSP00000473159
Symbol FFA2 GPCR43 GPR43 FFA2R GPR43
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp455948FFAR2free fatty acid receptor 29598VGNC:11096OMA, EggNOG
Macaque709026FFAR2free fatty acid receptor 29544Inparanoid, OMA, EggNOG
Mouse233079Ffar2free fatty acid receptor 210090MGI:2441731Inparanoid, OMA, EggNOG
Rat292794Ffar2free fatty acid receptor 210116RGD:1359614Inparanoid, OMA, EggNOG
Dog484580FFAR2free fatty acid receptor 29615VGNC:40831Inparanoid, OMA, EggNOG
Horse100059449FFAR2free fatty acid receptor 29796VGNC:51028Inparanoid, OMA, EggNOG
Cow522431FFAR2free fatty acid receptor 29913OMA, EggNOG
Opossum100015816FFAR2free fatty acid receptor 213616Inparanoid, OMA, EggNOG
PlatypusFFAR2free fatty acid receptor 2 [Source:HGNC Symbol;Acc:HGNC:4501]9258OMA, EggNOG

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.