Protein or Target Summary
Free fatty acid receptor 4
| Gene ID | 338557 |
|---|---|
| uniprot | Q5NUL3 |
| Gene Name | FFAR4 |
| Ensernbl ID | ENSP00000360538 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Free fatty acid receptor / Free fatty acid receptor 4
protein / G-protein coupled receptor / Class A rhodopsin like / Free fatty acid receptor / Free fatty acid receptor 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx