Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

FFAR4

DescriptionFree fatty acid receptor 4

Gene and Protein Information

Gene ID338557
Uniprot Accession IDs Q495H1 Q5VY25 Q5VY26 Q7Z605 Q86SM7
Ensembl ID ENSP00000360538
Symbol GPR120 GPR129 O3FAR1 PGR4 GT01 PGR4 BMIQ10 GPR120 GPR129 O3FAR1
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp740365FFAR4free fatty acid receptor 49598VGNC:3856OMA, EggNOG
Macaque700014FFAR4free fatty acid receptor 49544OMA, EggNOG
Mouse107221Ffar4free fatty acid receptor 410090MGI:2147577Inparanoid, OMA, EggNOG
Rat294075Ffar4free fatty acid receptor 410116RGD:1308252Inparanoid, OMA, EggNOG
Dog477774FFAR4free fatty acid receptor 49615VGNC:40832OMA, EggNOG
Horse100071163FFAR4free fatty acid receptor 49796VGNC:18002OMA, EggNOG
Cow533266FFAR4free fatty acid receptor 49913VGNC:28962OMA, EggNOG
PigFFAR4cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' [Source:RefSeq peptide;Acc:NP_001191695]9823OMA, EggNOG
Anole lizard100564065ffar4free fatty acid receptor 428377OMA, EggNOG
Xenopusffar4free fatty acid receptor 4 [Source:Xenbase;Acc:XB-GENE-954927]8364OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    Free fatty acid receptor 4
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Free fatty acid receptor    /    Free fatty acid receptor 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.