Protein or Target Summary

Free fatty acid receptor 4

Gene ID	338557
uniprot	Q5NUL3
Gene Name	FFAR4
Ensernbl ID	ENSP00000360538
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MSPECARAAGDAPLRSLEQANRTRFPFFSDVKGDHRLVLAAVETTVLVLIFAVSLLGNVCALVLVARRRRRGATACLVLNLFCADLLFISAIPLVLAVRWTEAWLLGPVACHLLFYVMTLSGSVTILTLAAVSLERMVCIVHLQRGVRGPGRRARAVLLALIWGYSAVAALPLCVFFRVVPQRLPGADQEISICTLIWPTIPGEISWDVSFVTLNFLVPGLVIVISYSKILQTSEHLLDARAVVTHSEITKASRKRLTVSLAYSESHQIRVSQQDFRLFRTLFLLMVSFFIMWSPIIITILLILIQNFKQDLVIWPSLFFWVVAFTFANSALNPILYNMTLCRNEWKKIFCCFWFPEKGAILTDTSVKRNDLSIISG Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	338557	FFAR4	Free fatty acid receptor 4	Q5NUL3
MOUSE	107221	Ffar4	G protein-coupled receptor 120	Q3V2S5
MOUSE	107221	Ffar4	Free fatty acid receptor 4	Q7TMA4
RAT	294075	Ffar4	Free fatty acid receptor 4	Q2AC31

PANTHER Classes
protein / receptor / G-protein coupled receptor / Free fatty acid receptor 4

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Free fatty acid receptor / Free fatty acid receptor 4

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source