The store will not work correctly when cookies are disabled.
FUT9
| Description | Alpha-(1,3)-fucosyltransferase 9 |
|---|
Gene and Protein Information
| Gene ID | 10690 |
|---|
| Uniprot Accession IDs | Q5T0W4 |
|---|
| Ensembl ID | ENSP00000302599 |
|---|
| Symbol | Fuc-TIX |
|---|
| Family | Belongs to the glycosyltransferase 10 family. |
|---|
| Sequence | MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 708361 | FUT9 | fucosyltransferase 9 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14348 | Fut9 | fucosyltransferase 9 | 10090 | MGI:1330859 | Inparanoid, OMA, EggNOG |
| Rat | 84597 | Fut9 | fucosyltransferase 9 | 10116 | RGD:619955 | Inparanoid, OMA |
| Dog | 449027 | FUT9 | fucosyltransferase 9 | 9615 | VGNC:41016 | Inparanoid, OMA, EggNOG |
| Horse | 100071396 | FUT9 | fucosyltransferase 9 | 9796 | VGNC:18160 | Inparanoid, OMA, EggNOG |
| Cow | 282853 | FUT9 | fucosyltransferase 9 | 9913 | VGNC:29153 | Inparanoid, OMA, EggNOG |
| Pig | 102160171 | FUT9 | fucosyltransferase 9 | 9823 | | OMA, EggNOG |
| Opossum | 100020278 | FUT9 | fucosyltransferase 9 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100075626 | FUT9 | fucosyltransferase 9 | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565195 | fut9 | fucosyltransferase 9 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 548391 | fut9 | fucosyltransferase 9 (alpha (1,3) fucosyltransferase) | 8364 | XB-GENE-966137 | Inparanoid, OMA, EggNOG |
| Zebrafish | 796410 | fut9a | fucosyltransferase 9a | 7955 | ZDB-GENE-080723-75 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
