The store will not work correctly when cookies are disabled.
Protein or Target Summary
Alpha-(1,3)-fucosyltransferase 9
| Gene ID | 10690 |
|---|
| uniprot | Q9Y231 |
|---|
| Gene Name | FUT9 |
|---|
| Ensernbl ID | ENSP00000302599 |
|---|
| Family | Belongs to the glycosyltransferase 10 family. |
|---|
| Sequence | MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 10690 | FUT9 | Alpha-(1,3)-fucosyltransferase 9 | Q9Y231 |
| MOUSE | 14348 | Fut9 | Fucosyltransferase 9 | Q14AE3 |
| MOUSE | 14348 | Fut9 | Alpha-(1,3)-fucosyltransferase 9 | O88819 |
| RAT | 84597 | Fut9 | Alpha-(1,3)-fucosyltransferase 9 | Q99JB3 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
