FOXA2
| Description | Hepatocyte nuclear factor 3-beta |
|---|
Gene and Protein Information
| Gene ID | 3170 |
|---|---|
| Uniprot Accession IDs | Q8WUW4 Q96DF7 HNF-3-beta |
| Ensembl ID | ENSP00000400341 |
| Symbol | HNF3B TCF3B HNF3B TCF3B |
| Sequence | MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 701771 | FOXA2 | forkhead box A2 | 9544 | Inparanoid, OMA | |
| Mouse | 15376 | Foxa2 | forkhead box A2 | 10090 | MGI:1347476 | Inparanoid, OMA |
| Rat | 25099 | Foxa2 | forkhead box A2 | 10116 | RGD:2808 | Inparanoid, OMA |
| Dog | 485742 | FOXA2 | forkhead box A2 | 9615 | VGNC:40944 | Inparanoid, OMA |
| Horse | 100147413 | FOXA2 | forkhead box A2 | 9796 | VGNC:51541 | Inparanoid, OMA |
| Cow | 503580 | FOXA2 | forkhead box A2 | 9913 | VGNC:29078 | Inparanoid, OMA |
| Pig | 100513828 | FOXA2 | forkhead box A2 | 9823 | Inparanoid, OMA | |
| Xenopus | 395063 | foxa2 | forkhead box A2 | 8364 | XB-GENE-480476 | Inparanoid, OMA |
| Zebrafish | 30126 | foxa2 | forkhead box A2 | 7955 | ZDB-GENE-980526-404 | Inparanoid, OMA |
Protein Classes
PANTHER Classes
protein / nucleic acid binding / DNA binding protein / Hepatocyte nuclear factor 3-beta
protein / nucleic acid binding / transcription factor / Hepatocyte nuclear factor 3-beta
protein / nucleic acid binding / winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-beta
protein / nucleic acid binding / DNA binding protein / Hepatocyte nuclear factor 3-beta
protein / nucleic acid binding / transcription factor / Hepatocyte nuclear factor 3-beta
protein / nucleic acid binding / winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-beta
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-beta
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Hepatocyte nuclear factor 3-beta
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|