The store will not work correctly when cookies are disabled.
Protein or Target Summary
Fatty acid-binding protein, heart
| Gene ID | 2170 |
|---|
| uniprot | P05413 |
|---|
| Gene Name | FABP3 |
|---|
| Ensernbl ID | ENSP00000362817 |
|---|
| Family | Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. |
|---|
| Sequence | MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2170 | FABP3 | Fatty acid-binding protein, heart | P05413 |
| MOUSE | 14077 | Fabp3 | Fatty acid binding protein 3, muscle and heart | Q5EBJ0 |
| MOUSE | 14077 | Fabp3 | Fatty acid-binding protein, heart | P11404 |
| RAT | 79131 | Fabp3 | Fatty acid-binding protein, heart | P07483 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
