The store will not work correctly when cookies are disabled.
FOLR1
| Description | Folate receptor alpha |
|---|
Gene and Protein Information
| Gene ID | 2348 |
|---|
| Uniprot Accession IDs | Q53EW2 Q6FGT8 Q6LC90 Q9UCT2 FR-alpha |
|---|
| Ensembl ID | ENSP00000377284 |
|---|
| Symbol | FOLR FBP FOLR |
|---|
| Family | Belongs to the folate receptor family. |
|---|
| Sequence | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 451401 | FOLR1 | folate receptor 1 | 9598 | VGNC:11775 | OMA, EggNOG |
| Macaque | 718388 | FOLR1 | folate receptor 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 14275 | Folr1 | folate receptor 1 (adult) | 10090 | MGI:95568 | Inparanoid, OMA |
| Rat | 171049 | Folr1 | folate receptor 1 | 10116 | RGD:71032 | Inparanoid, OMA, EggNOG |
| Dog | 609612 | FOLR1 | folate receptor 1 | 9615 | | Inparanoid, OMA, EggNOG |
| Horse | 100059683 | LOC100059683 | folate receptor alpha-like | 9796 | | Inparanoid, OMA |
| Cow | 539750 | FOLR1 | folate receptor 1 (adult) | 9913 | | OMA, EggNOG |
| Pig | | FOLR1 | folate receptor alpha precursor [Source:RefSeq peptide;Acc:NP_999476] | 9823 | | Inparanoid, OMA |
| Opossum | 100015645 | LOC100015645 | folate receptor alpha-like | 13616 | | OMA, EggNOG |
| Chicken | 395638 | FOLR1 | folate receptor 1 | 9031 | CGNC:49417 | OMA, EggNOG |
| Xenopus | 394697 | folr1 | folate receptor 1 (adult) | 8364 | XB-GENE-948101 | OMA, EggNOG |
| Zebrafish | 100073336 | zgc:165502 | zgc:165502 | 7955 | ZDB-GENE-070615-23 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
