JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

FGF17

Description	Fibroblast growth factor 17

Gene and Protein Information

Gene ID	8822
Uniprot Accession IDs	B7ZLG4 Q2M2W1 FGF-17
Ensembl ID	ENSP00000352414
Symbol	HH20 FGF-13 FGF-17
Family	Belongs to the heparin-binding growth factors family.
Sequence	MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472708	FGF17	fibroblast growth factor 17	9598	VGNC:12011	OMA, EggNOG
Mouse	14171	Fgf17	fibroblast growth factor 17	10090	MGI:1202401	Inparanoid, OMA, EggNOG
Rat	29368	Fgf17	fibroblast growth factor 17	10116	RGD:2607	Inparanoid, OMA, EggNOG
Dog	607952	FGF17	fibroblast growth factor 17	9615	VGNC:40844	Inparanoid, OMA, EggNOG
Horse	100056444	FGF17	fibroblast growth factor 17	9796	VGNC:18014	Inparanoid, OMA, EggNOG
Cow		FGF17	fibroblast growth factor 17 [Source:HGNC Symbol;Acc:HGNC:3673]	9913		OMA, EggNOG
Pig	100155720	FGF17	fibroblast growth factor 17	9823		OMA, EggNOG
Opossum	100030474	FGF17	fibroblast growth factor 17	13616		Inparanoid, EggNOG
Platypus	100088500	FGF17	fibroblast growth factor 17	9258		Inparanoid, OMA, EggNOG
Zebrafish	407737	fgf17	fibroblast growth factor 17	7955	ZDB-GENE-040621-1	Inparanoid, OMA

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 17

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 17

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source