JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Fibroblast growth factor 5

Gene ID	2250
uniprot	P12034
Gene Name	FGF5
Ensernbl ID	ENSP00000311697
Family	Belongs to the heparin-binding growth factors family.
Sequence	MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2250	FGF5	Fibroblast growth factor 5	P12034
MOUSE	14176	Fgf5	Fibroblast growth factor 5	P15656
RAT		Fgf5	Fibroblast growth factor	G3V8W5
RAT	60662	Fgf5	Fibroblast growth factor 5	P48807

Protein Classes

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 5

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx