JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Fibroblast growth factor 22

Gene ID	27006
uniprot	Q9HCT0
Gene Name	FGF22
Ensernbl ID	ENSP00000215530
Family	Belongs to the heparin-binding growth factors family.
Sequence	MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	27006	FGF22	Fibroblast growth factor 22	Q9HCT0
MOUSE		Fgf22	Fibroblast growth factor	A0A1X7SB63
MOUSE	67112	Fgf22	Fibroblast growth factor	Q0VER9
MOUSE	67112	Fgf22	Fibroblast growth factor 22	Q9ESS2
RAT	170579	Fgf22	Fibroblast growth factor	Q8VI79

Protein Classes

PANTHER Classes
protein / signaling molecule / growth factor / Fibroblast growth factor 22

DTO Classes
protein / Signaling / Growth factor / Fibroblast growth factor 22

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx