JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

FOSL2

Description	Fos-related antigen 2

Gene and Protein Information

Gene ID	2355
Uniprot Accession IDs	B2RD58 B3KP27 B4DYV4 Q6FG46 FRA-2
Ensembl ID	ENSP00000264716
Symbol	FRA2 FRA2
Family	Belongs to the bZIP family. Fos subfamily.
Sequence	MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Macaque	703068	FOSL2	FOS like 2, AP-1 transcription factor subunit	9544		Inparanoid, OMA, EggNOG
Mouse	14284	Fosl2	fos-like antigen 2	10090	MGI:102858	Inparanoid, OMA, EggNOG
Rat	25446	Fosl2	FOS like 2, AP-1 transcription factor subunit	10116	RGD:2628	Inparanoid, OMA
Dog	608412	FOSL2	FOS like 2, AP-1 transcription factor subunit	9615	VGNC:40943	Inparanoid, OMA, EggNOG
Horse	100071081	FOSL2	FOS like 2, AP-1 transcription factor subunit	9796	VGNC:18098	Inparanoid, OMA, EggNOG
Cow	509889	FOSL2	FOS like 2, AP-1 transcription factor subunit	9913	VGNC:29076	Inparanoid, OMA, EggNOG
Opossum		FOSL2	FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798]	13616		Inparanoid, EggNOG
Platypus		FOSL2	FOS like 2, AP-1 transcription factor subunit [Source:HGNC Symbol;Acc:HGNC:3798]	9258		OMA, EggNOG
Chicken	421416	FOSL2	FOS like 2, AP-1 transcription factor subunit	9031	CGNC:7631	Inparanoid, OMA, EggNOG
Anole lizard	100563265	fosl2	FOS like 2, AP-1 transcription factor subunit	28377		Inparanoid, OMA, EggNOG
Xenopus	100494449	fosl2	FOS-like antigen 2	8364	XB-GENE-6258093	Inparanoid, OMA, EggNOG
Zebrafish	558921	fosl2	fos-like antigen 2	7955	ZDB-GENE-070209-164	Inparanoid, OMA, EggNOG

PANTHER Classes
protein / basic leucine zipper transcription factor / Fos-related antigen 2

DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Fos-related antigen 2

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source