Protein or Target Summary
Fos-related antigen 2
| Gene ID | 2355 |
|---|---|
| uniprot | P15408 |
| Gene Name | FOSL2 |
| Ensernbl ID | ENSP00000264716 |
| Family | Belongs to the bZIP family. Fos subfamily. |
| Sequence | MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / Transcription factor / Basic leucine zipper transcription factor / Fos-related antigen 2
protein / Transcription factor / Basic leucine zipper transcription factor / Fos-related antigen 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: TCRDv6_DataSourcesLicenses.xlsx