The store will not work correctly when cookies are disabled.
KCNK17
| Description | Potassium channel subfamily K member 17 |
|---|
Gene and Protein Information
| Gene ID | 89822 |
|---|
| Uniprot Accession IDs | E9PB46 Q5TCF4 Q8TAW4 Q9BXD1 Q9H592 |
|---|
| Ensembl ID | ENSP00000362328 |
|---|
| Symbol | TALK2 TASK4 TALK2 TASK4 TALK-2 TASK-4 K2p17.1 |
|---|
| Family | Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. |
|---|
| Sequence | MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKWELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLAGSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPESHSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 748287 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9598 | VGNC:7898 | OMA, EggNOG |
| Macaque | 719574 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9544 | | OMA, EggNOG |
| Dog | 481781 | KCNK16 | potassium two pore domain channel subfamily K member 16 | 9615 | | OMA, EggNOG |
| Horse | 100065439 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9796 | VGNC:19295 | Inparanoid, OMA, EggNOG |
| Cow | 282264 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9913 | VGNC:30470 | Inparanoid, OMA, EggNOG |
| Pig | 106507367 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9823 | | OMA, EggNOG |
| Chicken | 421423 | KCNK17 | potassium two pore domain channel subfamily K member 17 | 9031 | CGNC:7653 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564501 | kcnk17 | potassium two pore domain channel subfamily K member 17 | 28377 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
