The store will not work correctly when cookies are disabled.
HNMT
| Description | Histamine N-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 3176 |
|---|
| Uniprot Accession IDs | B2R9J3 Q546Z6 Q7Z7I2 Q8IU56 Q8WW98 Q9BRW6 HMT |
|---|
| Ensembl ID | ENSP00000280097 |
|---|
| Symbol | HMT MRT51 HNMT-S1 HNMT-S2 |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. HNMT family. |
|---|
| Sequence | MASSMRSLFSDHGKYVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAGEIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLKYECYDLLSTMDISDCFIDGNENGDLLWDFLTETCNFNATAPPDLRAELGKDLQEPEFSAKKEGKVLFNNTLSFIVIEA |
|---|
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 3176 | HNMT | Histamine N-methyltransferase | P50135 |
| MOUSE | 140483 | Hnmt | Histamine N-methyltransferase | A2AQK4 |
| MOUSE | 140483 | Hnmt | Histamine N-methyltransferase | Q91VF2 |
| RAT | 81676 | Hnmt | Histamine N-methyltransferase | Q01984 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
