The store will not work correctly when cookies are disabled.
GSTP1
| Description | Glutathione S-transferase P |
|---|
Gene and Protein Information
| Gene ID | 2950 |
|---|
| Uniprot Accession IDs | O00460 Q15690 Q5TZY3 |
|---|
| Ensembl ID | ENSP00000381607 |
|---|
| Symbol | FAEES3 GST3 PI DFN7 GST3 GSTP FAEES3 HEL-S-22 |
|---|
| Family | Belongs to the GST superfamily. Pi family. |
|---|
| Sequence | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 745954 | GSTP1 | glutathione S-transferase pi 1 | 9598 | VGNC:6750 | OMA, EggNOG |
| Macaque | 721704 | GSTP1 | glutathione S-transferase pi 1 | 9544 | | Inparanoid, EggNOG |
| Mouse | 14869 | Gstp2 | glutathione S-transferase, pi 2 | 10090 | MGI:95864 | Inparanoid, OMA |
| Mouse | 14870 | Gstp1 | glutathione S-transferase, pi 1 | 10090 | MGI:95865 | OMA, EggNOG |
| Rat | 24426 | Gstp1 | glutathione S-transferase pi 1 | 10116 | RGD:2758 | Inparanoid, OMA, EggNOG |
| Horse | 100053249 | LOC100053249 | glutathione S-transferase P | 9796 | | OMA, EggNOG |
| Cow | 281806 | GSTP1 | glutathione S-transferase pi 1 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100739163 | LOC100739163 | glutathione S-transferase P-like | 9823 | | Inparanoid, EggNOG |
| Opossum | | GSTP1 | glutathione S-transferase pi 1 [Source:HGNC Symbol;Acc:HGNC:4638] | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565219 | LOC100565219 | glutathione S-transferase P | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 549395 | gstp1 | glutathione S-transferase pi 1 | 8364 | XB-GENE-5846243 | OMA, EggNOG |
| Zebrafish | 553169 | gstp2 | glutathione S-transferase pi 2 | 7955 | ZDB-GENE-050601-1 | Inparanoid, OMA |
| C. elegans | 189017 | gst-23 | Glutathione S-Transferase | 6239 | | OMA, EggNOG |
| C. elegans | 178725 | gst-10 | Glutathione S-Transferase | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
