The store will not work correctly when cookies are disabled.
Protein or Target Summary
Glutathione S-transferase P
| Gene ID | 2950 |
|---|
| uniprot | P09211 |
|---|
| Gene Name | GSTP1 |
|---|
| Ensernbl ID | ENSP00000381607 |
|---|
| Family | Belongs to the GST superfamily. Pi family. |
|---|
| Sequence | MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 2950 | GSTP1 | Glutathione S-transferase P | P09211 |
| MOUSE | 14870 | Gstp1 | Glutathione S-transferase P 1 | P19157 |
| RAT | 24426 | Gstp1 | Glutathione S-transferase pi | B6DYQ7 |
| RAT | 24426 | Gstp1 | Glutathione S-transferase P | P04906 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
