Protein or Target Summary
Histone acetyltransferase type B catalytic subunit
| Gene ID | 8520 |
|---|---|
| uniprot | O14929 |
| Gene Name | HAT1 |
| Ensernbl ID | ENSP00000264108 |
| Family | Belongs to the HAT1 family. |
| Sequence | MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQMNQIEISMQHEQLEESFQELVEDYRRVIERLAQE Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 8520 | HAT1 | Histone acetyltransferase type B catalytic subunit | O14929 |
| MOUSE | Hat1 | Histone acetyltransferase type B catalytic subunit | A2ATU9 | |
| MOUSE | 107435 | Hat1 | Histone acetyltransferase type B catalytic subunit | Q8BY71 |
| RAT | 296501 | Hat1 | Histone acetyltransferase type B catalytic subunit | Q5M939 |
Protein Classes
PANTHER Classes
protein / transferase / acetyltransferase / Histone acetyltransferase type B catalytic subunit
protein / transferase / acetyltransferase / Histone acetyltransferase type B catalytic subunit
DTO Classes
protein / Enzyme / Transferase / Acetyltransferase / Histone acetyltransferase type B catalytic subunit
protein / Enzyme / Transferase / Acetyltransferase / Histone acetyltransferase type B catalytic subunit
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx