The store will not work correctly when cookies are disabled.
Protein or Target Summary
Hypoxanthine-guanine phosphoribosyltransferase
Gene ID | 3251 |
uniprot | P00492 |
Gene Name | HPRT1 |
Ensernbl ID | ENSP00000298556 |
Family | Belongs to the purine/pyrimidine phosphoribosyltransferase family. |
Sequence | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 3251 | HPRT1 | Hypoxanthine-guanine phosphoribosyltransferase | P00492 |
MOUSE | | Hprt1 | Hypoxanthine-guanine phosphoribosyltransferase 1 | A0A0H3YJA6 |
MOUSE | 15452 | Hprt1 | Hypoxanthine-guanine phosphoribosyltransferase | P00493 |
RAT | 24465 | Hprt1 | Hypoxanthine-guanine phosphoribosyltransferase | P27605 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|